PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026683
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family YABBY
Protein Properties Length: 178aa    MW: 19887.8 Da    PI: 9.3993
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026683genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY129.83.5e-4041574166
        YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas.qllaaeshldeslkeelleelkveeenlksnvekeesastsvssek 100
                  ++  e++Cyv+C++Cn +l + +P + ++++vtv+CG C +l  ++       + ++ +  + +l    +  l ++++ l+   +k+++++ + ss k
  DCAR_026683   4 VQPYEHLCYVRCTYCNIVLEIRIPCKRMLETVTVKCGQCCNLSYLTAVPPPpVQSPSLDS-SATL----QSSLCSDSKRLQ---KKKKNKQLHCSSPK 93 
                  56789************************************9876654443144555554.3333....333333333332...23333333333322 PP

        YABBY 101 lsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPki 166
                    ++++ +++++p v++PPe++ r Psaynrf++eeiqrika+nP+i hr+afsaa+knWa    i
  DCAR_026683  94 --HESSSSSSNAPFVVKPPERKHRPPSAYNRFMREEIQRIKAANPNIPHRDAFSAASKNWARCSSI 157
                  ..333445556678***********************************************87666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.7E-467157IPR006780YABBY protein
SuperFamilySSF470952.49E-10100155IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.0E-6108155IPR009071High mobility group box domain
CDDcd013907.53E-8115155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MDPVQPYEHL CYVRCTYCNI VLEIRIPCKR MLETVTVKCG QCCNLSYLTA VPPPPVQSPS  60
LDSSATLQSS LCSDSKRLQK KKKNKQLHCS SPKHESSSSS SNAPFVVKPP ERKHRPPSAY  120
NRFMREEIQR IKAANPNIPH RDAFSAASKN WARCSSITNM PLFTTISESS NNVCTKE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010650015.18e-57PREDICTED: protein CRABS CLAW isoform X1
SwissprotQ76EJ03e-55YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A068TWY06e-57A0A068TWY0_COFCA; Uncharacterized protein
STRINGVIT_01s0011g00140.t013e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52102339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.12e-46YABBY family protein